PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06430.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 429aa    MW: 46301.9 Da    PI: 4.9906
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06430.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.73.6e-10145246
                                    SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                 Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                                    g W  eEd  l++ v+++G+++W++I ++  + Rt+k+c++rw +
  Zmw_sc06430.1.g00050.1.sm.mkhc  1 GTWAVEEDAVLLEHVRLHGPRDWSSIRSKGLLPRTGKSCRLRWVN 45
                                    689***********************8876677**********87 PP

2Myb_DNA-binding42.81.2e-135696345
                                    SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                 Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                                    ++++eE+   +d+ +++G++ W++Ia +++ gRt++++k++w 
  Zmw_sc06430.1.g00050.1.sm.mkhc 56 KFSPEEERVVLDLQAKFGNK-WARIATYLP-GRTDNDVKNFWS 96
                                    79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-15148IPR009057Homeodomain-like
SMARTSM007172.0E-6149IPR001005SANT/Myb domain
PROSITE profilePS5129415.287147IPR017930Myb domain
PfamPF002498.9E-9145IPR001005SANT/Myb domain
SuperFamilySSF466895.08E-25295IPR009057Homeodomain-like
CDDcd001672.15E-10247No hitNo description
PROSITE profilePS5129420.39448103IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-1849101IPR009057Homeodomain-like
SMARTSM007173.5E-1253101IPR001005SANT/Myb domain
CDDcd001671.39E-105695No hitNo description
PfamPF002494.4E-125696IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
GTWAVEEDAV LLEHVRLHGP RDWSSIRSKG LLPRTGKSCR LRWVNKLRPN LKSGCKFSPE  60
EERVVLDLQA KFGNKWARIA TYLPGRTDND VKNFWSTRQK RLARLRRSPR PGRPSRNISA  120
KKAAASSVAS EFSRCFFPDQ VPFEESFSSG QCRAATPSMD AENAAVIPYD QAGFQLDGLE  180
GAFLPVEPAT ESQACSSDAA PLLGKTDNVD VDDFWSTSQK QSSTLLCTPL PGQSSRNCGA  240
TTVAASSLQP PPAVGSFLDP VPFEGSFSAG QCCAGTTCIG AQNSELVPYD QTGSQLFDFG  300
GAQPTPPVAL ATDIQASSSN AASLWPPPLQ LYQSPYPLID FPGIPGSGDM TLGFVSAGAT  360
YDFAYHQEQL PLMQSPQMAF PIFGMHDGVK IEPRGLPPDH FDDLPPDMFD SADQLPPASS  420
PSRTISDLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-26110128126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978165.11e-84PREDICTED: myb-related protein MYBAS2
TrEMBLK3YCT21e-84K3YCT2_SETIT; Uncharacterized protein
STRINGSi012032m4e-84(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357